SPCS2 (NM_014752) Human Recombinant Protein

CAT#: TP310745

Recombinant protein of human signal peptidase complex subunit 2 homolog (S. cerevisiae) (SPCS2), 20 µg

Product Images

Coomassie blue staining of purified SPCS2 protein (Cat# TP310745). The protein was produced from HEK293T cells transfected with SPCS2 cDNA clone (Cat# RC210745) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210745 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLE
  KYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIF
  LVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEP
  EISRLHDSLAIERKIK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055567
• Locus ID: 9789
• UniProt ID: Q15005
• Cytogenetics: 11q13.4
• Refseq Size: 2731
• Refseq ORF: 678
• Summary: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function]
• Protein Families: Protease, Transmembrane