IL22 (NM_020525) Human Recombinant Protein

CAT#: TP309995M

Recombinant protein of human interleukin 22 (IL22), 100 µg

Product Images

Coomassie blue staining of purified IL22 protein (Cat# TP309995). The protein was produced from HEK293T cells transfected with IL22 cDNA clone (Cat# RC209995) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209995 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNT
  DVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLH
  IQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065386
• Locus ID: 50616
• UniProt ID: Q9GZX6
• Cytogenetics: 12q15
• Refseq Size: 1147
• Refseq ORF: 537
• Synonyms: IL-21; IL-22; IL-D110; IL-TIF; ILTIF; TIFa; TIFIL-23; zcyto18
• Summary: This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018]
• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway