NT5C3 (NT5C3A) (NM_001002009) Human Recombinant Protein
CAT#: TP309741
Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209741 protein sequence
Red=Cloning site Green=Tags(s) MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNI IDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDV MLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHV FNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVL VQDESLEVANSILQKIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002009 |
Locus ID | 51251 |
UniProt ID | Q9H0P0, A0A024RA81 |
Cytogenetics | 7p14.3 |
Refseq Size | 1782 |
Refseq ORF | 891 |
Synonyms | cN-III; hUMP1; NT5C3; P5'N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1 |
Summary | This gene encodes a member of the 5'-nucleotidase family of enzymes that catalyze the dephosphorylation of nucleoside 5'-monophosphates. The encoded protein is the type 1 isozyme of pyrimidine 5' nucleotidase and catalyzes the dephosphorylation of pyrimidine 5' monophosphates. Mutations in this gene are a cause of hemolytic anemia due to uridine 5-prime monophosphate hydrolase deficiency. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and pseudogenes of this gene are located on the long arm of chromosomes 3 and 4. [provided by RefSeq, Mar 2012] |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413931 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424318 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424319 | NT5C3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413931 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3 |
USD 436.00 |
|
LY424318 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 2 |
USD 436.00 |
|
LY424319 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 1 |
USD 436.00 |
|
PH305629 | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_057573) |
USD 3,255.00 |
|
PH309741 | NT5C3 MS Standard C13 and N15-labeled recombinant protein (NP_001002009) |
USD 3,255.00 |
|
TP305629 | Recombinant protein of human 5'-nucleotidase, cytosolic III (NT5C3), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review