KIAA0247 (SUSD6) (NM_014734) Human Recombinant Protein
CAT#: TP309240
Recombinant protein of human KIAA0247 (KIAA0247), 20 µg
Frequently bought together (2)
Other products for "KIAA0247"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209240 protein sequence
Red=Cloning site Green=Tags(s) MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPCRDPLTAGSVI EYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSIVASTASSVALILLLVVLFV LLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLSEGSGPSGRS VPREQQLPDQGACSSAGGEDEAPGQSGLCEAWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENS DIQSLLSLTSEEYTDDIPLLKEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055549 |
Locus ID | 9766 |
UniProt ID | Q92537 |
Cytogenetics | 14q24.1 |
Refseq Size | 5393 |
Refseq ORF | 909 |
Synonyms | DRAGO; KIAA0247 |
Summary | May play a role in growth-suppressive activity and cell death (PubMed:24652652). May be involved in the production of chemokine molecules in umbilical vein endothelial cells (HUVECs) cultured in THP1 monocyte LPS-induced medium (PubMed:20236627). Plays a role in preventing tumor onset (By similarity).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.