KIAA0247 (SUSD6) (NM_014734) Human Recombinant Protein

CAT#: TP309240

Recombinant protein of human KIAA0247 (KIAA0247), 20 µg

Product Images

Coomassie blue staining of purified SUSD6 protein (Cat# TP309240). The protein was produced from HEK293T cells transfected with SUSD6 cDNA clone (Cat# RC209240) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209240 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPCRDPLTAGSVI
  EYLCAEGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSIVASTASSVALILLLVVLFV
  LLQPKLKSFHHSRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLSEGSGPSGRS
  VPREQQLPDQGACSSAGGEDEAPGQSGLCEAWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENS
  DIQSLLSLTSEEYTDDIPLLKEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055549
• Locus ID: 9766
• UniProt ID: Q92537
• Cytogenetics: 14q24.1
• Refseq Size: 5393
• Refseq ORF: 909
• Synonyms: DRAGO; KIAA0247
• Summary: May play a role in growth-suppressive activity and cell death (PubMed:24652652). May be involved in the production of chemokine molecules in umbilical vein endothelial cells (HUVECs) cultured in THP1 monocyte LPS-induced medium (PubMed:20236627). Plays a role in preventing tumor onset (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane