VANGL1 (NM_138959) Human Recombinant Protein

CAT#: TP309024L

Recombinant protein of human vang-like 1 (van gogh, Drosophila) (VANGL1), 1 mg

Product Images

Coomassie blue staining of purified VANGL1 protein (Cat# TP309024). The protein was produced from HEK293T cells transfected with VANGL1 cDNA clone (Cat# RC209024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDD
  NWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRD
  ELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILD
  SRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVL
  ENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEH
  ERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM
  ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSL
  VVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 59.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620409
• Locus ID: 81839
• UniProt ID: Q8TAA9, A0A024R0E3
• Cytogenetics: 1p13.1
• Refseq Size: 8691
• Refseq ORF: 1572
• Synonyms: KITENIN; LPP2; STB2; STBM2
• Summary: This gene encodes a member of the tretraspanin family. The encoded protein may be involved in mediating intestinal trefoil factor induced wound healing in the intestinal mucosa. Mutations in this gene are associated with neural tube defects. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
• Protein Families: Transmembrane
• Protein Pathways: Wnt signaling pathway