GGA1 (NM_001001560) Human Recombinant Protein
CAT#: TP308305
Recombinant protein of human golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 2, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208305 protein sequence
Red=Cloning site Green=Tags(s) MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVL ETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLK KQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK ISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALGLS DPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPP ESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESI KPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG TELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001001560 |
Locus ID | 26088 |
UniProt ID | Q9UJY5 |
Cytogenetics | 22q13.1 |
Refseq Size | 2924 |
Refseq ORF | 1656 |
Summary | This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415668 | GGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC424381 | GGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC433284 | GGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC433376 | GGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415668 | Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 1 |
USD 665.00 |
|
LY424381 | Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 2 |
USD 436.00 |
|
LY433284 | Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 5 |
USD 436.00 |
|
LY433376 | Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 4 |
USD 436.00 |
|
PH308305 | GGA1 MS Standard C13 and N15-labeled recombinant protein (NP_001001560) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review