RNF11 (NM_014372) Human Recombinant Protein

CAT#: TP308220L

Recombinant protein of human ring finger protein 11 (RNF11), 1 mg

Product Images

Coomassie blue staining of purified RNF11 protein (Cat# TP308220). The protein was produced from HEK293T cells transfected with RNF11 cDNA clone (Cat# RC208220) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208220 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRI
  AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
  EPVDAALLSSYETN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055187
• Locus ID: 26994
• UniProt ID: Q9Y3C5
• Cytogenetics: 1p32.3
• Refseq Size: 3082
• Refseq ORF: 462
• Synonyms: CGI-123; SID1669
• Summary: The protein encoded by this gene contains a RING-H2 finger motif, which is known to be important for protein-protein interactions. The expression of this gene has been shown to be induced by mutant RET proteins (MEN2A/MEN2B). The germline mutations in RET gene are known to be responsible for the development of multiple endocrine neoplasia (MEN). [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome