TRAPPC1 (NM_021210) Human Recombinant Protein

CAT#: TP307483M

Recombinant protein of human trafficking protein particle complex 1 (TRAPPC1), 100 µg

Product Images

Coomassie blue staining of purified TRAPPC1 protein (Cat# TP307483). The protein was produced from HEK293T cells transfected with TRAPPC1 cDNA clone (Cat# RC207483) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207483 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK
  LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF
  SARAG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067033
• Locus ID: 58485
• UniProt ID: Q9Y5R8
• Cytogenetics: 17p13.1
• Refseq Size: 837
• Refseq ORF: 435
• Synonyms: BET5; MUM2
• Summary: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]