RDHE2 (SDR16C5) (NM_138969) Human Recombinant Protein
CAT#: TP306759
Recombinant protein of human short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206759 protein sequence
Red=Cloning site Green=Tags(s) MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLW DINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDE LMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFV QKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSF LPLKTGLLIADYLGILHAMDGFVDQKKKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620419 |
Locus ID | 195814 |
UniProt ID | Q8N3Y7, B3KT84 |
Cytogenetics | 8q12.1 |
Refseq Size | 3039 |
Refseq ORF | 927 |
Synonyms | EPHD-2; RDH#2; RDH-E2; RDHE2; retSDR2 |
Summary | This gene encodes a member of the short-chain alcohol dehydrogenase/reductase superfamily of proteins and is involved in the oxidation of retinol to retinaldehyde. The encoded protein is associated with the endoplasmic reticulum and is predicted to contain three transmembrane helices, suggesting that it is an integral membrane protein. It recognizes all-trans-retinol and all-trans-retinaldehyde as substrates and exhibits a strong preference for NAD(+)/NADH as cofactors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408444 | SDR16C5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408444 | Transient overexpression lysate of short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5) |
USD 436.00 |
|
PH306759 | SDR16C5 MS Standard C13 and N15-labeled recombinant protein (NP_620419) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review