RDHE2 (SDR16C5) Rabbit Polyclonal Antibody

CAT#: TA340321

Rabbit Polyclonal Anti-SDR16C5 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human short chain dehydrogenase/reductase family 16C, member 5 (SDR16C5), 20 µg
    • 20 ug

USD 867.00

Other products for "RDHE2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SDR16C5 antibody: synthetic peptide directed towards the middle region of human SDR16C5. Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name short chain dehydrogenase/reductase family 16C, member 5
Background The specific function of SDR16C5 is not yet known.SDR16C5 belongs to a family of short-chain alcohol dehydrogenases/reductases that catalyze the first and rate-limiting step that generates retinaldehyde from retinol (Matsuzaka et al., 2002 [PubMed 12372410]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-454 AB083038.1 1-454 455-1307 AK095159.1 549-1401 1308-2860 BC037219.1 749-2301 2861-3039 BC037219.1 2303-2481
Synonyms RDH#2; RDH-E2; RDHE2
Note Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 92%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.