ZCCHC13 (NM_203303) Human Recombinant Protein

CAT#: TP306078M

Recombinant protein of human zinc finger, CCHC domain containing 13 (ZCCHC13), 100 µg

Product Images

Coomassie blue staining of purified ZCCHC13 protein (Cat# TP306078). The protein was produced from HEK293T cells transfected with ZCCHC13 cDNA clone (Cat# RC206078) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206078 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC
  GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA
  INCSKARPGQLLPLRQIPTSSQGMSQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_976048
• Locus ID: 389874
• UniProt ID: Q8WW36
• Cytogenetics: Xq13.2
• Refseq Size: 859
• Refseq ORF: 498
• Synonyms: CNBP2; ZNF9L
• Summary: This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. [provided by RefSeq, May 2010]