OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZCCHC13 (NM_203303) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP306078
Recombinant protein of human zinc finger, CCHC domain containing 13 (ZCCHC13), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333326 Rabbit Polyclonal Anti-ZCCHC13 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ZCCHC13 or NM_203303"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206078 protein sequence
Red=Cloning site Green=Tags(s)

MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNC
GRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVA
INCSKARPGQLLPLRQIPTSSQGMSQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_976048
Locus ID 389874
UniProt ID Q8WW36
Cytogenetics Xq13.2
RefSeq Size 859
RefSeq ORF 498
Synonyms CNBP2; ZNF9L
Summary This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. The encoded protein contains six CCHC-type zinc fingers, and is thus thought to function as a transcription factor. provided by RefSeq, May 2010
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZCCHC13" proteins (4)
SKU Description Size Price
PH306078 ZCCHC13 MS Standard C13 and N15-labeled recombinant protein (NP_976048) 10 ug
$3,360.00
LC404386 Lyophilized ZCCHC13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404386 Transient overexpression lysate of zinc finger, CCHC domain containing 13 (ZCCHC13) (as WB positive control) 100 ug
$436.00
TP762528 Purified recombinant protein of Human zinc finger, CCHC domain containing 13 (ZCCHC13), full length, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products