GUCY1A1 (NM_000856) Human Recombinant Protein

CAT#: TP306063

Recombinant protein of human guanylate cyclase 1, soluble, alpha 3 (GUCY1A3), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified GUCY1A1 protein (Cat# TP306063). The protein was produced from HEK293T cells transfected with GUCY1A1 cDNA clone (Cat# RC206063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206063 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATMPICQDIPEKNIQESLPQRKTSRSRVY
  LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
  FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT
  TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS
  LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV
  RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
  AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF
  TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELS
  DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP
  GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 77.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000847
• Locus ID: 2982
• UniProt ID: Q02108
• Cytogenetics: 4q32.1
• Refseq Size: 9454
• Refseq ORF: 2070
• Synonyms: GC-S-alpha-1; GC-SA3; GCS-alpha-3; GUC1A3; GUCA3; GUCSA3; GUCY1A3; MYMY6
• Summary: Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction