GUCY1A1 (NM_000856) Human Mass Spec Standard

CAT#: PH306063

GUCY1A3 MS Standard C13 and N15-labeled recombinant protein (NP_000847)

Product Images

Coomassie blue staining of purified GUCY1A1 protein (Cat# TP306063). The protein was produced from HEK293T cells transfected with GUCY1A1 cDNA clone (Cat# RC206063) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206063
• Predicted MW: 77.5 kDa
• Protein Sequence:
  Sequence Link

  >RC206063 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFCTKLKDLKITGECPFSLLAPGQVPNESSEEAAGSSESCKATMPICQDIPEKNIQESLPQRKTSRSRVY
  LHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV
  FKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDDFLHVYYFFPKRT
  TSLILPGIIKAAAHVLYETEVEVSLMPPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTS
  LFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRV
  RRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
  AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGF
  TAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELS
  DEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCP
  GFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000847
• RefSeq Size: 9454
• RefSeq ORF: 2070
• Synonyms: GC-S-alpha-1; GC-SA3; GCS-alpha-3; GUC1A3; GUCA3; GUCSA3; GUCY1A3; MYMY6
• Locus ID: 2982
• UniProt ID: Q02108
• Cytogenetics: 4q32.1
• Summary: Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction