BMPR1A (NM_004329) Human Recombinant Protein
CAT#: TP306048
Recombinant protein of human bone morphogenetic protein receptor, type IA (BMPR1A), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206048 protein sequence
Red=Cloning site Green=Tags(s) MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLI DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004320 |
Locus ID | 657 |
UniProt ID | P36894 |
Cytogenetics | 10q23.2 |
Refseq Size | 3631 |
Refseq ORF | 1596 |
Synonyms | 10q23del; ACVRLK3; ALK3; CD292; SKR5 |
Summary | The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418061 | BMPR1A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418061 | Transient overexpression lysate of bone morphogenetic protein receptor, type IA (BMPR1A) |
USD 436.00 |
|
PH306048 | BMPR1A MS Standard C13 and N15-labeled recombinant protein (NP_004320) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review