TKTL2 (NM_032136) Human Recombinant Protein

CAT#: TP305557

Recombinant protein of human transketolase-like 2 (TKTL2), 20 µg

Product Images

Coomassie blue staining of purified TKTL2 protein (Cat# TP305557). The protein was produced from HEK293T cells transfected with TKTL2 cDNA clone (Cat# RC205557) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205557 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMANDAKPDVKTVQVLRDTANRLRIHSIRATCASGSGQLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDND
  RFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPFVDVATGSLGQGLGTACGMAYTG
  KYLDKASYRVFCLMGDGESSEGSVWEAFAFASHYNLDNLVAVFDVNRLGQSGPAPLEHGADIYQNCCEAF
  GWNTYLVDGHDVEALCQAFWQASQVKNKPTAIVAKTFKGRGIPNIEDAENWHGKPVPKERADAIVKLIES
  QIQTNENLIPKSPVEDSPQISVTDIKMTSPHAYKVGDKIATQKTYGLALAKLGRANERVIVLSGDTMNST
  FSEIFRKEHPERFIECIIAEQNMVSVALGCATRGRTIAFAGAFAAFFTRAFDQLRMGAISQANINLIGSH
  CGVSTGEDGVSQMALEDLAMFRSIPNCTVFYPSDAISTEHAIYLAANTKGMCFIRTSQPETAVIYTPQEN
  FEIGQAKVVRHGVNDKVTVIGAGVTLHEALEAADHLSQQGISVRVIDPFTIKPLDAATIISSAKATGGRV
  ITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRGKTSELLDMFGISTRHIIAAVTLTLMK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 67.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115512
• Locus ID: 84076
• UniProt ID: Q9H0I9, A0A140VKC2
• Cytogenetics: 4q32.2
• Refseq Size: 2837
• Refseq ORF: 1878
• Summary: Plays an essential role in total transketolase activity and cell proliferation in cancer cells; after transfection with anti-TKTL1 siRNA, total transketolase activity dramatically decreases and proliferation was significantly inhibited in cancer cells. Plays a pivotal role in carcinogenesis.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Metabolic pathways, Pentose phosphate pathway