CRHBP (NM_001882) Human Recombinant Protein

CAT#: TP305258

Recombinant protein of human corticotropin releasing hormone binding protein (CRHBP), 20 µg

Product Images

Coomassie blue staining of purified CRHBP protein (Cat# TP305258). The protein was produced from HEK293T cells transfected with CRHBP cDNA clone (Cat# RC205258) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205258 representing NM_001882
  Red=Cloning site Green=Tags(s)
  
  MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF
  TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF
  CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII
  YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT
  VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001873
• Locus ID: 1393
• UniProt ID: P24387
• Cytogenetics: 5q13.3
• Refseq Size: 1854
• Refseq ORF: 966
• Synonyms: CRF-BP; CRFBP
• Summary: Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]