CRHBP (NM_001882) Human Tagged ORF Clone

CAT#: RC205258

CRHBP (Myc-DDK-tagged)-Human corticotropin releasing hormone binding protein (CRHBP)

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CRHBP (NM_001882) Human Tagged ORF Clone
Symbol CRHBP
Synonyms CRF-BP; CRFBP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC205258 representing NM_001882
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCCCAACTTCAAACTTCAGTGTCACTTCATTCTCATCTTCCTGACGGCTCTAAGAGGGGAAAGCC
GGTACCTAGAGCTGAGGGAAGCGGCGGACTACGATCCTTTCCTGCTCTTCAGCGCCAACCTGAAGCGGGA
GCTGGCTGGGGAGCAGCCGTACCGCCGCGCTCTGCGGTGCCTGGACATGCTGAGCCTCCAGGGCCAGTTC
ACCTTCACCGCCGACCGGCCGCAGCTGCACTGCGCAGCCTTCTTCATCAGCGAGCCCGAGGAGTTCATTA
CCATCCACTACGACCAGGTCTCCATCGACTGTCAGGGCGGCGACTTCCTGAAGGTATTTGATGGTTGGAT
TCTCAAGGGGGAGAAGTTCCCCAGTTCCCAGGATCATCCTCTCCCCTCAGCTGAGCGGTACATAGATTTC
TGTGAGAGTGGTCTTAGCAGGAGGAGCATCAGATCTTCCCAGAATGTGGCCATGATCTTCTTCCGAGTCC
ATGAACCAGGAAATGGATTCACATTAACCATAAAGACAGACCCCAACCTCTTTCCTTGCAATGTCATTTC
TCAGACTCCAAATGGAAAGTTTACCCTGGTAGTTCCACACCAGCATCGAAACTGCAGCTTCTCCATAATT
TATCCTGTGGTGATCAAAATATCTGATCTTACCCTGGGACACGTAAATGGTCTTCAGTTAAAGAAATCCT
CAGCAGGTTGCGAGGGAATAGGAGACTTTGTGGAGCTGCTGGGAGGAACTGGATTGGACCCTTCCAAGAT
GACGCCTTTAGCTGATCTCTGCTACCCCTTTCATGGCCCGGCCCAGATGAAAGTTGGCTGTGACAACACT
GTGGTGCGCATGGTCTCCAGTGGAAAACACGTAAATCGTGTGACTTTTGAGTATCGTCAGCTGGAGCCGT
ACGAGCTGGAAAACCCAAATGGAAACAGTATCGGGGAATTCTGTTTGTCTGGTCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205258 representing NM_001882
Red=Cloning site Green=Tags(s)

MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF
TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF
CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII
YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT
VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001882
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001882.1, NM_001882.2, NM_001882.3, NP_001873
RefSeq Size 1854
RefSeq ORF 969
Locus ID 1393
Cytogenetics 5q13.3
MW 36 kDa
Gene Summary Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations