MIF (NM_002415) Human Recombinant Protein

CAT#: TP305106M

Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF), 100 µg

Product Images

Coomassie blue staining of purified MIF protein (Cat# TP305106). The protein was produced from HEK293T cells transfected with MIF cDNA clone (Cat# RC205106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205106 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
  AQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002406
• Locus ID: 4282
• UniProt ID: P14174, I4AY87
• Cytogenetics: 22q11.23
• Refseq Size: 561
• Refseq ORF: 345
• Synonyms: GIF; GLIF; MMIF
• Summary: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Phenylalanine metabolism, Tyrosine metabolism