SEC62 (NM_003262) Human Recombinant Protein
CAT#: TP304452
Recombinant protein of human SEC62 homolog (S. cerevisiae) (SEC62), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204452 representing NM_003262
Red=Cloning site Green=Tags(s) MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEA LFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKE KKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAA TLFPLWPAEMRVGVYYLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRP LYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRRED DRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003253 |
Locus ID | 7095 |
UniProt ID | Q99442 |
Cytogenetics | 3q26.2 |
Refseq Size | 6541 |
Refseq ORF | 1197 |
Synonyms | Dtrp1; HTP1; TLOC1; TP-1 |
Summary | The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. The encoded protein is an integral membrane protein located in the rough ER. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418802 | SEC62 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418802 | Transient overexpression lysate of SEC62 homolog (S. cerevisiae) (SEC62) |
USD 436.00 |
|
PH304452 | SEC62 MS Standard C13 and N15-labeled recombinant protein (NP_003253) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review