UBE2Q2 (NM_173469) Human Recombinant Protein

CAT#: TP304433M

Recombinant protein of human ubiquitin-conjugating enzyme E2Q family member 2 (UBE2Q2), transcript variant 1, 100 µg

Product Images

Coomassie blue staining of purified UBE2Q2 protein (Cat# TP304433). The protein was produced from HEK293T cells transfected with UBE2Q2 cDNA clone (Cat# RC204433) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204433 representing NM_173469
  Red=Cloning site Green=Tags(s)
  
  MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIW
  FVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEE
  EEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLM
  KELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPF
  DPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLAR
  AQQSYNSIVQIHEKNGWYTPPKEDG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_775740
• Locus ID: 92912
• UniProt ID: Q8WVN8
• Cytogenetics: 15q24.2
• Refseq Size: 2939
• Refseq ORF: 1125
• Summary: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Ubiquitin mediated proteolysis