NUDT4 (NM_019094) Human Recombinant Protein
CAT#: TP304100
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204100 protein sequence
Red=Cloning site Green=Tags(s) MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEE AGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEY LEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061967 |
Locus ID | 11163 |
UniProt ID | Q9NZJ9, A0A024RBD0 |
Cytogenetics | 12q22 |
Refseq Size | 4812 |
Refseq ORF | 543 |
Synonyms | DIPP-2B; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P; NUDT4B |
Summary | The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412753 | NUDT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412753 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1 |
USD 436.00 |
|
PH304100 | NUDT4 MS Standard C13 and N15-labeled recombinant protein (NP_061967) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review