NUDT4 (NM_019094) Human Mass Spec Standard
CAT#: PH304100
NUDT4 MS Standard C13 and N15-labeled recombinant protein (NP_061967)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204100 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC204100 protein sequence
Red=Cloning site Green=Tags(s) MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEE AGVKGKLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEY LEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_061967 |
RefSeq Size | 4812 |
RefSeq ORF | 543 |
Synonyms | DIPP-2B; DIPP2; DIPP2alpha; DIPP2beta; HDCMB47P; NUDT4B |
Locus ID | 11163 |
UniProt ID | Q9NZJ9, A0A024RBD0 |
Cytogenetics | 12q22 |
Summary | The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2alpha and DIPP2beta are distinguishable from each other solely by DIPP2beta possessing one additional amino acid due to intron boundary skidding in alternate splicing. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412753 | NUDT4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY412753 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1 |
USD 436.00 |
|
TP304100 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 4 (NUDT4), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review