WDR61 (NM_025234) Human Recombinant Protein

CAT#: TP303963L

Recombinant protein of human WD repeat domain 61 (WDR61), 1 mg

Product Images

Coomassie blue staining of purified WDR61 protein (Cat# TP303963). The protein was produced from HEK293T cells transfected with WDR61 cDNA clone (Cat# RC203963) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203963 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV
  DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK
  EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD
  DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV
  KYNGNGSKIVSVGDDQEIHIYDCPI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079510
• Locus ID: 80349
• UniProt ID: Q9GZS3
• Cytogenetics: 15q25.1
• Refseq Size: 1205
• Refseq ORF: 915
• Synonyms: REC14; SKI8
• Summary: WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM, Mar 2008]
• Protein Pathways: RNA degradation