WDR61 (NM_025234) Human Tagged ORF Clone

CAT#: RC203963

Reviews ()
Write a review

WDR61 (Myc-DDK-tagged)-Human WD repeat domain 61 (WDR61)



  "NM_025234" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol WDR61
Synonyms REC14; SKI8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC203963 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAACCAGTACGGTATTCTCTTCAAACAAGAGCAAGCCCATGATGATGCCATTTGGTCAGTTGCTT
GGGGGACAAACAAGAAGGAAAACTCTGAGACAGTGGTCACAGGCTCCCTAGATGACCTGGTGAAGGTCTG
GAAATGGCGTGATGAGAGGCTGGACCTACAGTGGAGTCTGGAGGGACATCAGCTGGGAGTGGTGTCTGTG
GACATCAGCCACACCCTGCCCATTGCTGCATCCAGCTCTCTTGATGCTCATATTCGTCTTTGGGACTTGG
AAAATGGCAAACAGATAAAGTCCATAGATGCAGGACCTGTGGATGCCTGGACTTTGGCCTTTTCTCCTGA
TTCCCAGTATCTGGCCACAGGAACTCATGTCGGGAAAGTGAACATTTTTGGTGTGGAAAGTGGGAAAAAG
GAATATTCTTTGGACACGAGAGGAAAATTCATTCTTAGTATTGCATATAGTCCTGATGGGAAATACCTAG
CCAGTGGAGCCATAGATGGAATCATCAATATTTTTGATATTGCAACTGGAAAACTTCTGCATACCCTGGA
AGGCCATGCCATGCCCATTCGCTCCTTGACCTTTTCCCCGGACTCCCAGCTCCTTGTCACTGCTTCAGAT
GATGGCTACATCAAGATCTATGATGTACAACATGCCAATTTGGCTGGCACGCTGAGCGGCCATGCCTCCT
GGGTGCTGAACGTTGCATTCTGTCCTGATGACACTCACTTTGTTTCCAGTTCGTCTGACAAAAGTGTAAA
AGTTTGGGATGTTGGAACGAGGACTTGTGTTCACACCTTCTTTGATCACCAGGATCAGGTCTGGGGAGTA
AAATACAATGGAAATGGTTCAAAAATTGTGTCTGTTGGAGATGACCAGGAAATTCACATCTATGATTGTC
CAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203963 protein sequence
Red=Cloning site Green=Tags(s)

MTNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSV
DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKK
EYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASD
DGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGV
KYNGNGSKIVSVGDDQEIHIYDCPI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025234
ORF Size 915 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025234.3
RefSeq Size 1205 bp
RefSeq ORF 918 bp
Locus ID 80349
UniProt ID Q9GZS3
Cytogenetics 15q25.1
Domains WD40
Protein Pathways RNA degradation
MW 33.6 kDa
Gene Summary WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM, Mar 2008]

Other Versions

Other products for "WDR61"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


WDR61 mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.