RAC3 (NM_005052) Human Recombinant Protein

CAT#: TP303325

Recombinant protein of human ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) (RAC3), 20 µg

Product Images

Coomassie blue staining of purified RAC3 protein (Cat# TP303325). The protein was produced from HEK293T cells transfected with RAC3 cDNA clone (Cat# RC203325) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203325 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL
  SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP
  QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005043
• Locus ID: 5881
• UniProt ID: P60763
• Cytogenetics: 17q25.3
• Refseq Size: 1077
• Refseq ORF: 576
• Summary: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Axon guidance, B cell receptor signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway