RAC3 (NM_005052) Human Tagged ORF Clone

CAT#: RC203325

Reviews ()
Write a review

RAC3 (Myc-DDK-tagged)-Human ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) (RAC3)


  "NM_005052" in other vectors (6)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name RAC3 (NM_005052) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RAC3
Synonyms ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); rho family, small GTP binding protein Rac3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203325 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCATCAAGTGCGTGGTGGTCGGCGACGGCGCCGTGGGGAAGACATGCTTGCTGATCAGCTACA
CGACCAACGCCTTCCCCGGAGAGTACATCCCCACCGTTTTTGACAACTACTCTGCCAACGTGATGGTGGA
CGGGAAACCAGTCAACTTGGGGCTGTGGGACACAGCGGGTCAGGAGGACTACGATCGGCTGCGGCCACTC
TCCTACCCCCAAACTGACGTCTTTCTGATCTGCTTCTCTCTGGTGAGCCCGGCCTCCTTCGAGAATGTTC
GTGCCAAGTGGTACCCGGAGGTGCGGCACCACTGCCCCCACACGCCCATCCTCCTGGTGGGCACCAAGCT
GGACCTCCGCGACGACAAGGACACCATTGAGCGGCTGCGGGACAAGAAGCTGGCACCCATCACCTACCCA
CAGGGCCTGGCCATGGCCCGGGAGATTGGCTCTGTGAAATACCTGGAGTGCTCAGCCCTGACCCAGCGGG
GCCTGAAGACAGTGTTTGACGAGGCGATCCGCGCGGTGCTCTGCCCGCCCCCAGTGAAGAAGCCGGGGAA
GAAGTGCACCGTCTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203325 protein sequence
Red=Cloning site Green=Tags(s)

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPL
SYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYP
QGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005052
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005052.1, NM_005052.2, NP_005043.1
RefSeq Size 1077
RefSeq ORF 579
Locus ID 5881
Cytogenetics 17q25.3
Domains ras, RAS, RHO, RAB
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, B cell receptor signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Focal adhesion, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway
MW 21.4 kDa
Gene Summary The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Other Versions

Other products for "RAC3"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools