HINT1 (NM_005340) Human Recombinant Protein
CAT#: TP303319
Recombinant protein of human histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203319 protein sequence
Red=Cloning site Green=Tags(s) MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005331 |
Locus ID | 3094 |
UniProt ID | P49773, A0A384NPU2 |
Cytogenetics | 5q23.3 |
Refseq Size | 689 |
Refseq ORF | 378 |
Synonyms | HINT; NMAN; PKCI-1; PRKCNH1 |
Summary | This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417372 | HINT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY417372 | Transient overexpression lysate of histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1 |
USD 436.00 |
|
PH303319 | HINT1 MS Standard C13 and N15-labeled recombinant protein (NP_005331) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review