BHMT (NM_001713) Human Recombinant Protein

CAT#: TP303148M

Recombinant protein of human betaine-homocysteine methyltransferase (BHMT), 100 µg

Product Images

Coomassie blue staining of purified BHMT protein (Cat# TP303148). The protein was produced from HEK293T cells transfected with BHMT cDNA clone (Cat# RC203148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203148 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV
  MQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAGGVSQTPSYLSCKSETEVKKV
  FLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKPVAATMCIGPEGDLHGVPPGECAVRLVKAGA
  SIIGVNCHFDPTISLKTVKLMKEGLEAARLKAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWD
  IQKYAREAYNLGVRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKE
  YWENLRIASGRPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 44.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001704
• Locus ID: 635
• UniProt ID: Q93088, V9HWA4
• Cytogenetics: 5q14.1
• Refseq Size: 2515
• Refseq ORF: 1218
• Synonyms: BHMT1; HEL-S-61p
• Summary: This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provided by RefSeq, Jul 2008]
• Protein Pathways: Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways