C5orf19 (REEP2) (NM_016606) Human Recombinant Protein

CAT#: TP302507M

Recombinant protein of human receptor accessory protein 2 (REEP2), 100 µg

Product Images

Coomassie blue staining of purified REEP2 protein (Cat# TP302507). The protein was produced from HEK293T cells transfected with REEP2 cDNA clone (Cat# RC202507) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202507 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI
  AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG
  VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED
  DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057690
• Locus ID: 51308
• UniProt ID: Q9BRK0, A8K3D2
• Cytogenetics: 5q31.2
• Refseq Size: 2203
• Refseq ORF: 756
• Synonyms: C5orf19; SGC32445; SPG72; Yip2d
• Summary: This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2012]
• Protein Families: Druggable Genome, Transmembrane