HNRNPD (NM_031370) Human Recombinant Protein
CAT#: TP301796
Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201796 representing NM_031370
Red=Cloning site Green=Tags(s) MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDA SKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGF GFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVES IELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRAR GRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQN SYKPY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_112738 |
Locus ID | 3184 |
UniProt ID | Q14103, A1LU37 |
Cytogenetics | 4q21.22 |
Refseq Size | 2257 |
Refseq ORF | 1065 |
Synonyms | AUF1; AUF1A; hnRNPD0; HNRPD; P37 |
Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410547 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC410548 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419510 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424021 | HNRNPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410547 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2 |
USD 436.00 |
|
LY410548 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 1 |
USD 436.00 |
|
LY419510 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3 |
USD 436.00 |
|
LY424021 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4 |
USD 436.00 |
|
PH300660 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_002129) |
USD 3,255.00 |
|
PH301796 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112738) |
USD 3,255.00 |
|
PH320809 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_001003810) |
USD 3,255.00 |
|
PH322094 | HNRNPD MS Standard C13 and N15-labeled recombinant protein (NP_112737) |
USD 3,255.00 |
|
TP300660 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, 20 µg |
USD 867.00 |
|
TP320809 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 4, 20 µg |
USD 867.00 |
|
TP322094 | Purified recombinant protein of Homo sapiens heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 2, 20 µg |
USD 867.00 |
|
TP760280 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa) (HNRNPD), transcript variant 3, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review