ZDHHC4 (NM_018106) Human Recombinant Protein
CAT#: TP301489
Recombinant protein of human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201489 protein sequence
Red=Cloning site Green=Tags(s) MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIV LHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEF DEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI VSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYL AATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060576 |
Locus ID | 55146 |
UniProt ID | Q9NPG8, A0A024QZS8 |
Cytogenetics | 7p22.1 |
Refseq Size | 1413 |
Refseq ORF | 1032 |
Synonyms | ZNF374 |
Summary | Palmitoyltransferase that could catalyze the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402650 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427411 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427412 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427413 | ZDHHC4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402650 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3 |
USD 436.00 |
|
LY427411 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 1 |
USD 436.00 |
|
LY427412 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 2 |
USD 436.00 |
|
LY427413 | Transient overexpression lysate of zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 4 |
USD 436.00 |
|
PH301489 | ZDHHC4 MS Standard C13 and N15-labeled recombinant protein (NP_060576) |
USD 3,255.00 |
|
TP761502 | Purified recombinant protein of Human zinc finger, DHHC-type containing 4 (ZDHHC4), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review