ZDHHC4 (NM_018106) Human Mass Spec Standard

CAT#: PH301489

ZDHHC4 MS Standard C13 and N15-labeled recombinant protein (NP_060576)

Product Images

Coomassie blue staining of purified ZDHHC4 protein (Cat# TP301489). The protein was produced from HEK293T cells transfected with ZDHHC4 cDNA clone (Cat# RC201489) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201489
• Predicted MW: 39.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201489 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQRAVHGLLHYLFHTRNHTFIV
  LHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEF
  DEVMFPKNVRCSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVAI
  VSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPRIVFMLGFVVVLSFLLGGYLLFVLYL
  AATNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060576
• RefSeq Size: 1413
• RefSeq ORF: 1032
• Synonyms: ZNF374
• Locus ID: 55146
• UniProt ID: Q9NPG8, A0A024QZS8
• Cytogenetics: 7p22.1
• Summary: Palmitoyltransferase that could catalyze the addition of palmitate onto protein substrates including the D(2) dopamine receptor DRD2.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane