NCF1 (NM_000265) Human Recombinant Protein
CAT#: TP301233M
Recombinant protein of human neutrophil cytosolic factor 1 (NCF1), 100 µg
Frequently bought together (2)
Other products for "NCF1"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201233 representing NM_000265
Red=Cloning site Green=Tags(s) MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme substrate (PMID: 29195919) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000256 |
Locus ID | 653361 |
UniProt ID | P14598 |
Cytogenetics | 7q11.23 |
Refseq Size | 1409 |
Refseq ORF | 1170 |
Synonyms | CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A |
Summary | The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008] |
Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.