Chemerin (RARRES2) (NM_002889) Human Recombinant Protein

CAT#: TP300383L

Recombinant protein of human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), 1 mg

Product Images

Coomassie blue staining of purified RARRES2 protein (Cat# TP300383). The protein was produced from HEK293T cells transfected with RARRES2 cDNA clone (Cat# RC200383) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200383 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF
  KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR
  AGEDPHSFYFPGQFAFSKALPRS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002880
• Locus ID: 5919
• UniProt ID: Q99969, A0A090N7U9
• Cytogenetics: 7q36.1
• Refseq Size: 767
• Refseq ORF: 489
• Synonyms: HP10433; TIG2
• Summary: This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Secreted Protein