Chemerin (RARRES2) (NM_002889) Human Tagged ORF Clone

CAT#: RC200383

RARRES2 (Myc-DDK-tagged)-Human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2)



  "NM_002889" in other vectors (6)

Reconstitution Protocol

USD 150.00

USD 225.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "RARRES2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RARRES2
Synonyms HP10433; TIG2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200383 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGACGGCTGCTGATCCCTCTGGCCCTGTGGCTGGGCGCGGTGGGCGTGGGCGTCGCCGAGCTCACGG
AAGCCCAGCGCCGGGGCCTGCAGGTGGCCCTGGAGGAATTTCACAAGCACCCGCCCGTGCAGTGGGCCTT
CCAGGAGACCAGTGTGGAGAGCGCCGTGGACACGCCCTTCCCAGCTGGAATATTTGTGAGGCTGGAATTT
AAGCTGCAGCAGACAAGCTGCCGGAAGAGGGACTGGAAGAAACCCGAGTGCAAAGTCAGGCCCAATGGGA
GGAAACGGAAATGCCTGGCCTGCATCAAACTGGGCTCTGAGGACAAAGTTCTGGGCCGGTTGGTCCACTG
CCCCATAGAGACCCAAGTTCTGCGGGAGGCTGAGGAGCACCAGGAGACCCAGTGCCTCAGGGTGCAGCGG
GCTGGTGAGGACCCCCACAGCTTCTACTTCCCTGGACAGTTCGCCTTCTCCAAGGCCCTGCCCCGCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200383 protein sequence
Red=Cloning site Green=Tags(s)

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR
AGEDPHSFYFPGQFAFSKALPRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002889
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002889.4
RefSeq Size 767 bp
RefSeq ORF 492 bp
Locus ID 5919
UniProt ID Q99969
Cytogenetics 7q36.1
Protein Families Druggable Genome, Nuclear Hormone Receptor, Secreted Protein
MW 18.6 kDa
Gene Summary This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.