DGCR6L (NM_033257) Human Recombinant Protein

CAT#: TP300317

Recombinant protein of human DiGeorge syndrome critical region gene 6-like (DGCR6L), 20 µg

Product Images

Coomassie blue staining of purified DGCR6L protein (Cat# TP300317). The protein was produced from HEK293T cells transfected with DGCR6L cDNA clone (Cat# RC200317) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
  QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK
  IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ
  CDQKGSPVPP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_150282
• Locus ID: 85359
• UniProt ID: Q9BY27
• Cytogenetics: 22q11.21
• Refseq Size: 1217
• Refseq ORF: 660
• Synonyms: DGCR6
• Summary: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors