DGCR6L (NM_033257) Human Mass Spec Standard

CAT#: PH300317

DGCR6L MS Standard C13 and N15-labeled recombinant protein (NP_150282)

Product Images

Coomassie blue staining of purified DGCR6L protein (Cat# TP300317). The protein was produced from HEK293T cells transfected with DGCR6L cDNA clone (Cat# RC200317) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200317
• Predicted MW: 24.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200317 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEI
  QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQK
  IILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQ
  CDQKGSPVPP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_150282
• RefSeq Size: 1217
• RefSeq ORF: 660
• Synonyms: DGCR6
• Locus ID: 85359
• UniProt ID: Q9BY27
• Cytogenetics: 22q11.21
• Summary: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product of this gene is a protein that shares homology with the Drosophila gonadal protein, expressed in gonadal tissues and germ cells, and with the human laminin gamma-1 chain that functions in cell attachment and migration. This gene is located in a region of chromosome 22 implicated in the DiGeorge syndrome, one facet of a broader collection of anomalies referred to as the CATCH 22 syndrome. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors