POLDIP2 (NM_015584) Human Recombinant Protein

CAT#: TP300053M

Recombinant protein of human polymerase (DNA-directed), delta interacting protein 2 (POLDIP2), 100 µg

Product Images

Coomassie blue staining of purified POLDIP2 protein (Cat# TP300053). The protein was produced from HEK293T cells transfected with POLDIP2 cDNA clone (Cat# RC200053) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200053 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEV
  PKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDA
  RDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP
  FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLR
  ERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP
  FSLESNKDEKTPPSGLHW
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056399
• Locus ID: 26073
• UniProt ID: Q9Y2S7
• Cytogenetics: 17q11.2
• Refseq Size: 2753
• Refseq ORF: 1104
• Synonyms: p38; PDIP38; POLD4
• Summary: This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit, as well as with proliferating cell nuclear antigen. The encoded protein maybe play a role in the ability of the replication fork to bypass DNA lesions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]