POLDIP2 (NM_015584) Human Tagged ORF Clone

CAT#: RC200053

Reviews ()
Write a review

POLDIP2 (Myc-DDK-tagged)-Human polymerase (DNA-directed), delta interacting protein 2 (POLDIP2)



  "NM_015584" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POLDIP2
Synonyms p38; PDIP38; POLD4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200053 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCCTGTACAGCCCGGCGGGCCCTGGCCGTGGGCAGCCGCTGGTGGTCCCGGTCGCTGACTGGGG
CCCGGTGGCCAAGGCCGCTCTGTGCGGCGGCCGGAGCTGGAGCCTTCTCGCCAGCGTCGACCACGACGAC
GCGGAGGCACCTCTCGTCCCGAAACCGACCAGAGGGCAAAGTGTTGGAGACAGTTGGTGTGTTTGAGGTG
CCAAAACAGAATGGAAAATATGAGACCGGGCAGCTTTTCCTTCATAGCATTTTTGGCTACCGAGGTGTCG
TCCTGTTTCCCTGGCAGGCCAGACTGTATGACCGGGATGTGGCTTCTGCAGCTCCAGAAAAAGCAGAGAA
CCCTGCTGGCCATGGCTCCAAGGAGGTGAAAGGCAAAACTCACACTTACTATCAGGTGCTGATTGATGCT
CGTGACTGCCCACATATATCTCAGAGATCTCAGACAGAAGCTGTGACCTTCTTGGCTAACCATGATGACA
GTCGGGCCCTCTATGCCATCCCAGGCTTGGACTATGTCAGCCATGAAGACATCCTCCCCTACACCTCCAC
TGATCAGGTTCCCATCCAACATGAACTCTTTGAAAGATTTCTTCTGTATGACCAGACAAAAGCACCTCCT
TTTGTGGCTCGGGAGACGCTAAGGGCCTGGCAAGAGAAGAATCACCCCTGGCTGGAGCTCTCCGATGTTC
ATCGGGAAACAACTGAGAACATACGTGTCACTGTCATCCCCTTCTACATGGGCATGAGGGAAGCCCAGAA
TTCCCACGTGTACTGGTGGCGCTACTGTATCCGTTTGGAGAACCTTGACAGTGATGTGGTACAGCTCCGG
GAGCGGCACTGGAGGATATTCAGTCTCTCTGGCACCTTGGAGACAGTGCGAGGCCGAGGGGTAGTGGGCA
GGGAACCAGTGTTATCCAAGGAGCAGCCTGCGTTCCAGTATAGCAGCCACGTCTCGCTGCAGGCTTCCAG
TGGGCACATGTGGGGCACGTTCCGCTTTGAAAGACCTGATGGCTCCCACTTTGATGTTCGGATTCCTCCC
TTCTCCCTGGAAAGCAATAAAGATGAGAAGACACCACCCTCAGGCCTTCACTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200053 protein sequence
Red=Cloning site Green=Tags(s)

MAACTARRALAVGSRWWSRSLTGARWPRPLCAAAGAGAFSPASTTTTRRHLSSRNRPEGKVLETVGVFEV
PKQNGKYETGQLFLHSIFGYRGVVLFPWQARLYDRDVASAAPEKAENPAGHGSKEVKGKTHTYYQVLIDA
RDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPP
FVARETLRAWQEKNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLR
ERHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPP
FSLESNKDEKTPPSGLHW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015584
ORF Size 1104 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015584.5
RefSeq Size 2753 bp
RefSeq ORF 1107 bp
Locus ID 26073
UniProt ID Q9Y2S7
Cytogenetics 17q11.2
Domains DUF525
MW 42 kDa
Gene Summary This gene encodes a protein that interacts with the DNA polymerase delta p50 subunit, as well as with proliferating cell nuclear antigen. The encoded protein maybe play a role in the ability of the replication fork to bypass DNA lesions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Other Versions

Other products for "POLDIP2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.