EXOSC3 (NM_016042) Human Recombinant Protein

CAT#: TP300035L

Recombinant protein of human exosome component 3 (EXOSC3), transcript variant 1, 1 mg

Product Images

Coomassie blue staining of purified EXOSC3 protein (Cat# TP300035). The protein was produced from HEK293T cells transfected with EXOSC3 cDNA clone (Cat# RC200035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200035 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPG
  LRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPAS
  LSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKL
  LAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057126
• Locus ID: 51010
• UniProt ID: Q9NQT5
• Cytogenetics: 9p13.2
• Refseq Size: 1857
• Refseq ORF: 825
• Synonyms: bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
• Summary: This gene encodes a non-catalytic component of the human exosome, a complex with 3'-5' exoribonuclease activity that plays a role in numerous RNA processing and degradation activities. Related pseudogenes of this gene are found on chromosome 19 and 21. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2012]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation