SUGT1 (NM_001130912) Human Mass Spec Standard
CAT#: PH325548
SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225548 |
Predicted MW | 40.8 kDa |
Protein Sequence |
>RC225548 representing NM_001130912
Red=Cloning site Green=Tags(s) MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR KVEINPPDDMEWKKY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001124384 |
RefSeq ORF | 1095 |
Synonyms | SGT1 |
Locus ID | 10910 |
UniProt ID | Q9Y2Z0, A8K7W3 |
Cytogenetics | 13q14.3 |
Summary | This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416475 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427302 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416475 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 |
USD 436.00 |
|
LY427302 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 |
USD 436.00 |
|
PH301676 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695) |
USD 3,255.00 |
|
TP301676 | Recombinant protein of human SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP325548 | Purified recombinant protein of Homo sapiens SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review