CLEC12B (NM_001129998) Human Mass Spec Standard

CAT#: PH325378

CLEC12B MS Standard C13 and N15-labeled recombinant protein (NP_001123470)

Product Images

Coomassie blue staining of purified CLEC12B protein (Cat# TP325378). The protein was produced from HEK293T cells transfected with CLEC12B cDNA clone (Cat# RC225378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225378
• Predicted MW: 31.4 kDa
• Protein Sequence:
  Sequence Link

  >RC225378 representing NM_001129998
  Red=Cloning site Green=Tags(s)
  
  MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND
  INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC
  NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS
  SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001123470
• RefSeq ORF: 828
• Synonyms: UNQ5782
• Locus ID: 387837
• UniProt ID: Q2HXU8, A0A140VK10
• Cytogenetics: 12p13.2
• Summary: Cell surface receptor that protects target cells against natural killer cell-mediated lysis. Modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane