LRSAM1 (NM_001005374) Human Mass Spec Standard
CAT#: PH323778
LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005374)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223778 |
Predicted MW | 83.6 kDa |
Protein Sequence |
>RC223778 protein sequence
Red=Cloning site Green=Tags(s) MPLFFRKRKPSEEARKRLEYQMCLAKEAGADDILDISKCELSEIPFGAFATCKVLQKKVLIVHTNHLTSL LPKSCSLLSLATIKVLDLHDNQLTALPDDLGQLTALQVLNVERNQLMQLPRSIGNLTQLQTLNVKDNKLK ELPDTVGELRSLRTLNISGNEIQRLPQMLAHVRTLEMLSLDASAMVYPPREVCGAGTAAILQFLCKESGL EYYPPSQYLLPILEQDGIENSRDSPDGPTDRFSREELEWQNRFSDYEKRKEQKMLEKLEFERRLELGQRE HTQLLQQSSSQKDEILQTVKEEQSRLEQGLSEHQRHLDAERQRLQEQLKQTEQNISSRIQKLLQDNQRQK KSSEILKSLENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSS MAEMDERFQQILSWQQMDQNKAISQILQESAMQKAAFEALQVKKDLMHRQIRSQIKLIETELLQLTQLEL KRKSLDTESLQEMISEQRWALSSLLQQLLKEKQQREEELREILTELEAKSETRQENYWLIQYQRLLNQKP LSLKLQEEGMERQLVALLEELSAEHYLPIFAHHRLSLDLLSQMSPGDLAKVGVSEAGLQHEILRRVQELL DAARIQPELKPPMGEVVTPTAPQEPPESVRPSAPPAELEVQASECVVCLEREAQMIFLNCGHVCCCQQCC QPLRTCPLCRQDIAQRLRIYHSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001005374 |
RefSeq Size | 2851 |
RefSeq ORF | 2169 |
Synonyms | CMT2P; RIFLE; TAL |
Locus ID | 90678 |
UniProt ID | Q6UWE0, A0A024R870 |
Cytogenetics | 9q33.3-q34.11 |
Summary | This gene encodes a ring finger protein involved in a variety of functions, including regulation of signaling pathways and cell adhesion, mediation of self-ubiquitylation, and involvement in cargo sorting during receptor endocytosis. Mutations in this gene have been associated with Charcot-Marie-Tooth disease. Multiple transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408632 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423706 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423707 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC434379 | LRSAM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY408632 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1 |
USD 436.00 |
|
LY423706 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2 |
USD 436.00 |
|
LY423707 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3 |
USD 665.00 |
|
LY434379 | Transient overexpression lysate of leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 4 |
USD 665.00 |
|
PH300920 | LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_001005373) |
USD 3,255.00 |
|
PH315025 | LRSAM1 MS Standard C13 and N15-labeled recombinant protein (NP_612370) |
USD 3,255.00 |
|
TP300920 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP315025 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP323778 | Recombinant protein of human leucine rich repeat and sterile alpha motif containing 1 (LRSAM1), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review