beta Casein (CSN2) (NM_001891) Human Mass Spec Standard
CAT#: PH323777
CSN2 MS Standard C13 and N15-labeled recombinant protein (NP_001882)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223777 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC223777 protein sequence
Red=Cloning site Green=Tags(s) MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVE PIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLH LPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQI YPVTQPLAPVHNPISV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001882 |
RefSeq Size | 1078 |
RefSeq ORF | 678 |
Synonyms | CASB; PDC213 |
Locus ID | 1447 |
UniProt ID | P05814, W5RWE1 |
Cytogenetics | 4q13.3 |
Summary | This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2020] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419688 | CSN2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419688 | Transient overexpression lysate of casein beta (CSN2) |
USD 436.00 |
|
TP323777 | Recombinant protein of human casein beta (CSN2), 20 µg |
USD 867.00 |
|
TP721167 | Purified recombinant protein of Human casein beta (CSN2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review