DGKA (NM_001345) Human Mass Spec Standard
CAT#: PH322395
DGKA MS Standard C13 and N15-labeled recombinant protein (NP_001336)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222395 |
Predicted MW | 82.5 kDa |
Protein Sequence |
>RC222395 representing NM_001345
Red=Cloning site Green=Tags(s) MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001336 |
RefSeq Size | 2756 |
RefSeq ORF | 2205 |
Synonyms | DAGK; DAGK1; DGK-alpha |
Locus ID | 1606 |
UniProt ID | P23743, A0A024RB23 |
Cytogenetics | 12q13.2 |
Summary | The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400535 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404426 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404427 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC404458 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC430856 | DGKA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY400535 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3 |
USD 436.00 |
|
LY404426 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
USD 436.00 |
|
LY404427 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2 |
USD 665.00 |
|
LY404458 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4 |
USD 436.00 |
|
LY430856 | Transient overexpression lysate of diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1 |
USD 665.00 |
|
PH302930 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958852) |
USD 3,255.00 |
|
PH318968 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_958853) |
USD 3,255.00 |
|
PH320293 | DGKA MS Standard C13 and N15-labeled recombinant protein (NP_963848) |
USD 3,255.00 |
|
TP302930 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 1, 20 µg |
USD 867.00 |
|
TP318968 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 2, 20 µg |
USD 867.00 |
|
TP320293 | Recombinant protein of human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 4, 20 µg |
USD 867.00 |
|
TP322395 | Purified recombinant protein of Homo sapiens diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review