DGKA (NM_001345) Human Tagged ORF Clone

CAT#: RC222395

Reviews ()
Write a review

DGKA (Myc-DDK-tagged)-Human diacylglycerol kinase, alpha 80kDa (DGKA), transcript variant 3


  View "NM_001345" in other vectors (10)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DGKA (NM_001345) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DGKA
Synonyms DAGK; DAGK1; DGK-alpha
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC222395 representing NM_001345
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAGGAGAGGGGCCTAATAAGCCCCAGTGATTTTGCCCAGCTGCAAAAATACATGGAATACTCCA
CCAAAAAGGTCAGTGATGTCCTAAAGCTCTTCGAGGATGGCGAGATGGCTAAATATGTCCAAGGAGATGC
CATTGGGTACGAGGGATTCCAGCAATTCCTGAAAATCTATCTCGAAGTGGATAATGTTCCCAGACACCTA
AGCCTGGCACTGTTTCAATCCTTTGAGACTGGTCACTGCTTAAATGAGACAAATGTGACAAAAGATGTGG
TGTGTCTCAATGATGTTTCCTGCTACTTTTCCCTTCTGGAGGGTGGTCGGCCAGAAGACAAGTTAGAATT
CACCTTCAAGCTGTACGACACGGACAGAAATGGGATCCTGGACAGCTCAGAAGTGGACAAAATTATCCTA
CAGATGATGCGAGTGGCTGAATACCTGGATTGGGATGTGTCTGAGCTGAGGCCGATTCTTCAGGAGATGA
TGAAAGAGATTGACTATGATGGCAGTGGCTCTGTCTCTCAAGCTGAGTGGGTCCGGGCTGGGGCCACCAC
CGTGCCACTGCTAGTGCTGCTGGGTCTGGAGATGACTCTGAAGGACGACGGACAGCACATGTGGAGGCCC
AAGAGGTTCCCCAGACCAGTCTACTGCAATCTGTGCGAGTCAAGCATTGGTCTTGGCAAACAGGGACTGA
GCTGTAACCTCTGTAAGTACACTGTTCACGACCAGTGTGCCATGAAAGCCCTGCCTTGTGAAGTCAGCAC
CTATGCCAAGTCTCGGAAGGACATTGGTGTCCAATCACATGTGTGGGTGCGAGGAGGCTGTGAGTCCGGG
CGCTGCGACCGCTGTCAGAAAAAGATCCGGATCTACCACAGTCTGACCGGGCTGCATTGTGTATGGTGCC
ACCTAGAGATCCACGATGACTGCCTGCAAGCGGTGGGCCATGAGTGTGACTGTGGGCTGCTCCGGGATCA
CATCCTGCCTCCATCTTCCATCTATCCCAGTGTCCTGGCCTCTGGACCGGATCGTAAAAATAGCAAAACA
AGCCAGAAGACCATGGATGATTTAAATTTGAGCACCTCTGAGGCTCTGCGGATTGACCCTGTTCCTAACA
CCCACCCACTTCTCGTCTTTGTCAATCCTAAGAGTGGCGGGAAGCAGGGGCAGAGGGTGCTCTGGAAGTT
CCAGTATATATTAAACCCTCGACAGGTGTTCAACCTCCTAAAGGATGGTCCTGAGATAGGGCTCCGATTA
TTCAAGGATGTTCCTGATAGCCGGATTTTGGTGTGTGGTGGAGACGGCACAGTAGGCTGGATTCTAGAGA
CCATTGACAAAGCTAACTTGCCAGTTTTGCCTCCTGTTGCTGTGTTGCCCCTGGGTACTGGAAATGATCT
GGCTCGATGCCTAAGATGGGGAGGAGGTTATGAAGGACAGAATCTGGCAAAGATCCTCAAGGATTTAGAG
ATGAGTAAAGTGGTACATATGGATCGATGGTCTGTGGAGGTGATACCTCAACAAACTGAAGAAAAAAGTG
ACCCAGTCCCCTTTCAAATCATCAATAACTACTTCTCTATTGGCGTGGATGCCTCTATTGCTCATCGATT
CCACATCATGCGAGAGAAATATCCGGAGAAGTTCAACAGCAGAATGAAGAACAAGCTATGGTACTTCGAA
TTTGCCACATCTGAATCCATCTTCTCAACATGCAAAAAGCTGGAGGAGTCTTTGACAGTTGAGATCTGTG
GGAAACCGCTGGATCTGAGCAACCTGTCCCTAGAAGGCATCGCAGTGCTAAACATCCCTAGCATGCATGG
TGGCTCCAACCTCTGGGGTGATACCAGGAGACCCCATGGGGATATCTATGGGATCAACCAGGCCTTAGGT
GCTACAGCTAAAGTCATCACCGACCCTGATATCCTGAAAACCTGTGTACCAGACCTAAGTGACAAGAGAC
TGGAAGTGGTTGGGCTGGAGGGTGCAATTGAGATGGGCCAAATCTATACCAAGCTCAAGAATGCTGGACG
TCGGCTGGCCAAGTGCTCTGAGATCACCTTCCACACCACAAAAACCCTTCCCATGCAAATTGACGGAGAA
CCCTGGATGCAGACGCCCTGTACAATCAAGATCACCCACAAGAACCAGATGCCCATGCTCATGGGCCCAC
CCCCCCGCTCCACCAATTTCTTTGGCTTCTTGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222395 representing NM_001345
Red=Cloning site Green=Tags(s)

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHL
SLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIIL
QMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRP
KRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESG
RCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT
SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLE
MSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFE
FATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALG
ATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE
PWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001345
ORF Size 2205 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001345.1, NM_001345.2, NM_001345.3, NM_001345.4, NP_001336.2
RefSeq Size 2756
RefSeq ORF 2208
Locus ID 1606
Cytogenetics 12q13.2
Domains DAGKa, DAGKc, EFh, DAG_PE-bind
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system
MW 82.5 kDa
Gene Summary The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important role in the resynthesis of phosphatidylinositols and phosphorylating diacylglycerol to phosphatidic acid. Several transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Apr 2017]

Other Versions

Other products for "DGKA"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones