Hemopexin (HPX) (NM_000613) Human Mass Spec Standard

CAT#: PH322271

HPX MS Standard C13 and N15-labeled recombinant protein (NP_000604)

Product Images

Coomassie blue staining of purified HPX protein (Cat# TP322271). The protein was produced from HEK293T cells transfected with HPX cDNA clone (Cat# RC222271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC222271
• Predicted MW: 51.68 kDa
• Protein Sequence:
  Sequence Link

  >RC222271 representing NM_000613
  Red=Cloning site Green=Tags(s)
  
  MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFF
  KGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIP
  SPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFD
  PVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGT
  HYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG
  TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
  NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000604
• RefSeq Size: 1389
• RefSeq ORF: 1386
• Synonyms: HX
• Locus ID: 3263
• UniProt ID: P02790, Q9BS19, Q5T248
• Cytogenetics: 11p15.4
• Summary: This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009]
• Protein Families: Secreted Protein