Hemopexin (HPX) (NM_000613) Human Recombinant Protein

CAT#: TP322271

Recombinant protein of human hemopexin (HPX), 20 µg

Product Images

Coomassie blue staining of purified HPX protein (Cat# TP322271). The protein was produced from HEK293T cells transfected with HPX cDNA clone (Cat# RC222271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC222271 representing NM_000613
  Red=Cloning site Green=Tags(s)
  
  MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFF
  KGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIP
  SPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFD
  PVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGT
  HYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG
  TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
  NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000604
• Locus ID: 3263
• UniProt ID: P02790, Q9BS19, Q5T248
• Cytogenetics: 11p15.4
• Refseq Size: 1389
• Refseq ORF: 1386
• Synonyms: HX
• Summary: This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009]
• Protein Families: Secreted Protein