SKA1 (NM_001039535) Human Mass Spec Standard
CAT#: PH321913
SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_001034624)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221913 |
Predicted MW | 29.5 kDa |
Protein Sequence |
>RC221913 protein sequence
Red=Cloning site Green=Tags(s) MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSL KELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFI TCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYF IVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001034624 |
RefSeq Size | 2938 |
RefSeq ORF | 765 |
Synonyms | C18orf24 |
Locus ID | 220134 |
UniProt ID | Q96BD8, A0A024R294 |
Cytogenetics | 18q21.1 |
Summary | Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation (PubMed:17093495, PubMed:19289083, PubMed:23085020). Required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint (PubMed:17093495). The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies (PubMed:19289083). The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner (PubMed:19289083). Affinity for microtubules is synergistically enhanced in the presence of the ndc-80 complex and may allow the ndc-80 complex to track depolymerizing microtubules (PubMed:23085020). In the complex, it mediates the interaction with microtubules (PubMed:19289083, PubMed:23085020).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408057 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422066 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425642 | SKA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY408057 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 1 (SKA1), transcript variant 2 |
USD 436.00 |
|
LY422066 | Transient overexpression lysate of spindle and kinetochore associated complex subunit 1 (SKA1), transcript variant 1 |
USD 436.00 |
|
PH302370 | SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_659497) |
USD 3,255.00 |
|
TP302370 | Recombinant protein of human chromosome 18 open reading frame 24 (C18orf24), transcript variant 2, 20 µg |
USD 867.00 |
|
TP321913 | Recombinant protein of human chromosome 18 open reading frame 24 (C18orf24), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review